PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT03885
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 267aa    MW: 30919.9 Da    PI: 10.0556
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT03885genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM120.31.7e-37171162103
       NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvgl 102
               +pGfrFhPtdeelv++yLkkk+++k++++ e i+++diyk++PwdLpk ++++e++wyf+++rd+ky+++ r+nr+t++g+Wkatg+d++++s++g +   
  EMT03885  17 MPGFRFHPTDEELVSFYLKKKIQQKPISI-ELIRQLDIYKFDPWDLPKLASTGETDWYFYCPRDRKYRNSARPNRVTAAGFWKATGTDRPIYSSEG-TRSS 115
               69***************************.89***************88888999*************************************9544.4444 PP

       NAM 103 k 103
               +
  EMT03885 116 R 116
               4 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.37E-3816118IPR003441NAC domain
PROSITE profilePS5100534.93616162IPR003441NAC domain
PfamPF023652.7E-1618108IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 267 aa     Download sequence    Send to blast
MEGINDVNMD KSDEIIMPGF RFHPTDEELV SFYLKKKIQQ KPISIELIRQ LDIYKFDPWD  60
LPKLASTGET DWYFYCPRDR KYRNSARPNR VTAAGFWKAT GTDRPIYSSE GTRSSRRPVR  120
WHNKWRCPTL GGLHYLRQLS KISSPQCNRC KLQILLHRAP SAHRKLQRHQ QVSSTANMGS  180
RDNNSFRNPA THRMALHARL NVGMSSRNQD SSTMKHGNTF SMNNELDAPG RLNFPFDLGA  240
DSSDDWKCNI PWESFLSPTV PAEMPQY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-341811319113NO APICAL MERISTEM PROTEIN
1ut4_B4e-341811319113NO APICAL MERISTEM PROTEIN
1ut7_A4e-341811319113NO APICAL MERISTEM PROTEIN
1ut7_B4e-341811319113NO APICAL MERISTEM PROTEIN
4dul_A4e-341811319113NAC domain-containing protein 19
4dul_B4e-341811319113NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCP0126166e-41CP012616.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 8 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003574551.13e-72PREDICTED: protein FEZ-like
TrEMBLM8AQ750.0M8AQ75_AEGTA; Putative NAC domain-containing protein 9
STRINGBRADI3G37067.19e-72(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP43632158
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G26870.11e-60NAC family protein